null Skip to main content
Sign in

LL-37 | 5mg

LL-37 | 5mg
SKU:
LL37
Calculating active researchers...
£67.00
Adding to cart… The item has been added
Dispatched via Royal Mail Tracked

Product Overview

LL-37 (Cathelicidin Antimicrobial Peptide) is a synthetic 37-amino acid sequence derived from the C-terminal domain of the human cationic antimicrobial protein hCAP18. Classified as a cationic, amphipathic alpha-helical peptide, it plays a prominent role in the innate immune system. Laboratory researchers utilise this compound extensively to investigate mechanisms of inflammatory modulation, membrane permeabilisation, and chemotactic signalling in in vitro and animal models.

This compound undergoes stringent analytical testing to ensure structural integrity and molecular precision for laboratory applications. Each batch is synthesised and purified to exceed analytical standards, providing researchers with a dependable reagent for cellular assays, receptor-binding investigations, and immune pathway mapping.

Technical Specifications

  • Chemical Name: Cathelicidin Antimicrobial Peptide (LL-37)
  • CAS Number: 154947-66-7
  • Sequence: [LL-37, 37 aa]
  • Molecular Formula: C205H340N60O53
  • Molecular Weight: 4493.3 g/mol
  • Target: Formyl peptide receptor 2 (FPR2) and lipid bilayers
  • Mechanism: Membrane modulation and chemotactic signalling
  • Half-Life: ~30-60 minutes
  • Format: Lyophilised Solid
  • Appearance: White crystalline powder
  • Grade: Laboratory / Analytical Grade
  • Purity: >99% HPLC Verified

Variant Breakdown

  • 5mg Lyophilised Vial
  • Closure: Rubber stopper with flip-off aluminium seal.

Research Mechanism (Mechanism of Action)

  1. Receptor Binding & Membrane Interaction: LL-37 exerts its primary effects by binding to the formyl peptide receptor 2 (FPR2) expressed on leukocytes and epithelial cells. Concurrently, its cationic alpha-helical structure allows it to interact directly with negatively charged lipid bilayers in laboratory models.
  2. Signal Transduction: The interaction with FPR2 triggers intracellular calcium mobilisation and modulates mitogen-activated protein kinase (MAPK) cascades. This biochemical response alters the transcription of specific genes associated with inflammatory signalling.
  3. Cellular Response: The ensuing pathway cascade leads to the targeted recruitment of immune cells (chemotaxis) and regulates the local inflammatory environment. This mechanism makes LL-37 an essential reagent for mapping innate immune responses and cellular defence mechanisms.

Safety, Handling & Reconstitution

Accurate reconstitution is required to maintain the structural integrity of the peptide. Utilise Bacteriostatic Reconstitution Solution (0.9% Benzyl Alcohol) for optimal dissolution. Store the lyophilised solid desiccated at -20°C, protected from light. Once reconstituted, the solution must be stored between 2°C and 8°C. This material is strictly for Laboratory Research Purposes Only.

Scientific References (External Links)

The Journal of Immunology: “The human antimicrobial peptide LL-37 is a multifunctional modulator of innate immune responses” View Study

Journal of Experimental Medicine: “LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells” View Study

Journal of Investigative Dermatology: “The human antimicrobial peptide LL-37 suppresses apoptosis in keratinocytes” View Study

Cellular and Molecular Life Sciences: “Cathelicidin LL-37: a multitask antimicrobial peptide” View Study

Recently Viewed

loading

 

 
loading

 

 
loading