Skip to main content
In-Vitro Research Only
Sign in

IGF-1 LR3 Peptide Research Grade | 1mg | Buy Online UK

IGF-1 LR3 Peptide Research Grade | 1mg | Buy Online UK
SKU:
IFG1-LR3-AP
Calculating active researchers...
€69.41
Adding to cart… The item has been added
International Tracked (5-10 Days)

What is IGF-1 LR3 Peptide Research Grade?

Insulin-like Growth Factor-1 Long Arg3 (IGF-1 LR3) is an 83-amino acid analogue of human IGF-1, engineered specifically for enhanced potency and prolonged cellular interactions in vitro. Through advanced peptide synthesis techniques, this modified variant incorporates an arginine substitution at position three and a 13-amino acid N-terminal extension. These structural modifications significantly reduce its affinity for IGF-binding proteins, allowing for sustained receptor activation. As a premium research chemical, UK laboratories utilise this peptide extensively for cellular proliferation assays, where it demonstrates exceptional molecular stability during extended incubation periods. Researchers must employ precise reconstitution protocols using Bacteriostatic Reconstitution Solution to maintain the structural integrity of the lyophilised peptide. By activating the PI3K/AKT and MAPK signalling cascades, this reagent drives critical cellular processes, including protein synthesis and cellular differentiation. For further insights into related growth factor pathways, researchers can explore literature on advancing the somatotropic frontier. Additional biochemical characterisation is documented extensively within PubMed databases.

Research FAQ
Igf 1 lr3 uk price
IGF-1 LR3 is available for UK laboratory procurement. Prices vary based on volume, but Amino Peptides ensures competitive pricing with next-day dispatch on in-stock vials. Strictly for laboratory research.
IGF-1 LR3 dosage
Current literature uses the search phrase "dosage" when indexing laboratory cell-proliferation models. Research trends summarise those papers as observations in isolated cell cultures, not as a consumer protocol. Amino Peptides supplies this compound only as a lyophilised laboratory reagent. Strictly for laboratory research.
Igf 1 lr3 uk for sale
Yes, IGF-1 LR3 is listed for UK laboratory procurement. Amino Peptides provides high-purity, HPLC-checked vials with next-day delivery options. Strictly for laboratory research.
IGF-1 LR3 peptide benefits
Published studies discussed under this heading frequently use the term "benefits" to describe cellular responses in tissue repair models. These observations are strictly confined to isolated lab experiments. Amino Peptides supplies this compound only as a lyophilised laboratory reagent. Strictly for laboratory research.
IGF-1 LR3 before and after
Public search data clusters around the phrase "before and after" when looking for visual results. However, current literature documents these changes exclusively at the microscopic level in laboratory cell cultures. Amino Peptides supplies this compound only as a lyophilised laboratory reagent. Strictly for laboratory research.
How should I store this peptide?
Unmixed vials can be safely stored in a standard refrigerator (2-8°C) for up to 3 months without degradation. Once reconstituted with Bacteriostatic Reconstitution Solution, the liquid must be kept refrigerated and used within its validated half-life.
Laboratory Authority Record

Public search data frequently uses terms like "benefits" and "dosage" when exploring IGF-1 LR3. Current literature and research trends index these phrases to describe cellular proliferation and tissue repair in isolated laboratory models. These published studies focus entirely on microscopic cell cultures rather than bodily outcomes. Amino Peptides supplies this compound strictly as a lyophilised laboratory reagent.

Target Receptors
  • High-affinity binding to the Type 1 Insulin-like Growth Factor Receptor (IGF-1R), a receptor tyrosine kinase, initiating trans-autophosphorylation in cell-free systems.
  • Negligible affinity for Insulin-like Growth Factor Binding Proteins (IGFBPs), preventing sequestration and prolonging receptor interaction in controlled molecular environments.
  • Interaction with the insulin receptor (IR) at significantly lower affinities, mapped during competitive binding experiments in isolated cellular membranes.
  • Modulation of integrin receptor complexes via cross-talk mechanisms observed in extracellular matrix adhesion models.
Mechanisms of Action
  • Activation of the PI3K/AKT signalling cascade, promoting downstream phosphorylation of mTOR and driving protein synthesis in isolated myoblast cultures.
  • Stimulation of the Ras/Raf/MEK/ERK pathway, initiating transcription factor translocation and cellular proliferation in laboratory models.
  • Inhibition of FOXO transcription factors via AKT-mediated phosphorylation, preventing apoptosis and enhancing cell survival in nutrient-deprived cell cultures.
  • Upregulation of cyclin D1 expression, facilitating G1 to S phase cell cycle progression during controlled cytological experiments.

Technical Specifications

CAS
143045-27-6
MOLECULAR FORMULA
C400H625N111O115S6
MOLECULAR WEIGHT
9111.6
SEQUENCE
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
PURITY
>99% (HPLC Verified)
APPEARANCE
Lyophilised Solid
TARGET RECEPTOR
Type 1 IGF Receptor (IGF-1R)
HALF-LIFE
20-30 hours (in vitro)
CHEMICAL NAME
Long Arg3 Insulin-like Growth Factor-1
ENDOTOXIN LIMIT
<0.5 EU/mg
SOLUBILITY
Soluble in dilute acetic acid or Bacteriostatic Reconstitution Solution
RECOMMENDED SOLVENT
Bacteriostatic Reconstitution Solution

Variant Breakdown

  • 1mg Vial: Provides a highly concentrated lyophilised powder, ideal for precise laboratory stock preparation and multiple in-vitro assays.

Quality Assurance

  • HPLC Verification: High-performance liquid chromatography ensures a purity level exceeding 99 percent, confirming the absence of synthesis by-products.
  • Mass Spectrometry: Advanced mass analysis confirms the exact molecular weight and structural sequence of the synthesised peptide.
  • Lyophilised Stability: Processed into a stable lyophilised solid to preserve molecular integrity during transport and long-term laboratory storage.
  • Endotoxin Testing: Rigorous laboratory characterisation guarantees endotoxin limits remain below 0.5 EU/mg for optimal cell culture viability.

Research Mechanism

  • Receptor Binding: Binds to the type 1 IGF receptor (IGF-1R) on the cellular membrane with high affinity, initiating a cascade of intracellular signals.
  • Decreased Binding Protein Affinity: The structural modifications prevent binding to IGF-binding proteins (IGFBPs), vastly increasing the availability of the free, active peptide in culture media.
  • PI3K/AKT Activation: Stimulates the phosphoinositide 3-kinase (PI3K) pathway, which upregulates AKT phosphorylation to promote cellular survival and inhibit apoptosis.
  • MAPK Pathway Induction: Activates the mitogen-activated protein kinase (MAPK) cascade, driving cellular proliferation and differentiation in various tissue models.
  • Metabolic Regulation: Enhances amino acid uptake and stimulates protein synthesis in cultured myoblasts and other target cell lines.

Reconstitution & Storage Data

Vial StrengthSolvent AddedResulting Concentration
1mg1 mL Bacteriostatic Reconstitution Solution1.00 mg/mL
1mg2 mL Bacteriostatic Reconstitution Solution0.50 mg/mL
Storage Guidelines
  • Lyophilised (Powder): Store in a standard refrigerator (2-8°C) for up to 3 months. For long-term preservation, freeze at -20°C.
  • Reconstituted (Liquid): Store at 2-8°C (Refrigerated).

Scientific References

Journal of Endocrinology: "Biological activities of IGF-1 and its analogues in cultured mammalian cells" View Study

Endocrinology: "The role of IGF-1 LR3 in stimulating myoblast proliferation and differentiation" View Study

Growth Hormone & IGF Research: "Structural modifications of IGF-1 and their impact on IGFBP affinity" View Study

Molecular and Cellular Endocrinology: "Activation of PI3K and MAPK pathways by IGF-1 analogues in vitro" View Study

Recently Viewed

loading

 

 
loading

 

 
loading